Jannah Theme License is not validated, Go to the theme options page to validate the license, You need a single license for each domain name.
Valmiki RamayanaYuddha Kanda

Valmiki Ramayana Yuddha Kanda Sarga 74 Shloka 49

️ मूल श्लोक (Original Shloka)

स पुच्छमुद्यम्यभुजङ्गकल्पंविनम्यपृष्ठंश्रवणेनिकुञ्च्य । विवृत्यवक्त्रंबडबामुखाभमापुफ्लुवेव्योमनिचण्डवेगः ।।6.74.49।।

Shloka Translation (IAST)

sa pucchamudyamyabhujangakalpaminamyaprsthamsravanenikuncya | vivrtyavaktrambadabamukhabhamaapufluvevyomanicandavegah || 6.74.49 ||

Shloka Meaning in English

Raising his tail which resembled a serpent, bending his back, and ears, opening his mouth wide expounded Hanuman sprang up at terrific speed.

श्लोक का हिंदी अर्थ (Shloka Meaning in Hindi)

यह श्लोक हनुमान की शक्ति और तेज़ी का वर्णन करता है। वह अपनी पूंछ को सर्प के समान उठाते हैं और तेजी से कूदते हैं, जिससे उनकी शक्ति और साहस का पता चलता है।

Life Lessons

Life Lessons in English

This verse teaches us the importance of harnessing our inner strength and courage to face challenges. Just like Hanuman, we should be ready to spring into action with determination.

जीवन पाठ (Life Lessons in Hindi)

यह श्लोक हमें अपनी आंतरिक शक्ति और साहस का उपयोग करने का महत्व सिखाता है। हनुमान की तरह, हमें भी दृढ़ संकल्प के साथ कार्रवाई के लिए तैयार रहना चाहिए।

Practical Application

Practical Application in English

In today’s fast-paced world, we can apply this lesson by being proactive and taking initiative in our personal and professional lives. Embracing challenges with confidence can lead to significant growth and success.

व्यावहारिक अनुप्रयोग (Practical Application in Hindi)

आज की तेज़ी से बदलती दुनिया में, हम इस पाठ को अपने व्यक्तिगत और पेशेवर जीवन में सक्रिय रहने और पहल करने के रूप में लागू कर सकते हैं। आत्मविश्वास के साथ चुनौतियों का सामना करने से महत्वपूर्ण विकास और सफलता मिल सकती है।

Related Articles

Leave a Reply

Your email address will not be published. Required fields are marked *


Back to top button

Please Remove Ad Blocker

Please Remove Ad Blocker, To continue using this site.